>rubisco SVGFKAGVKDYKLTYYTPEYQPQDTDILAAFRVTPQPGVPSEEAGAAVAAESSTGTWTTV WTDGLTSLDRYKGRCYHIDAVPGEDNQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV YECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
Tree of Life Activity Part 1
Explore an Interactive Tree of Life
Scientists use DNA to study the relationship between different organisms throughout the tree of life, which is an area of study known as phylogenetics.
We can use DNA sequences of genes from animals or plants to investigate how closely related they are. Scientists compare DNA sequences of genes that are "highly conserved," which means they are so important that their sequence doesn’t change very much over time and most organisms need the gene to survive!
Changes, or mutations, to the DNA sequence of a gene can be meaningful and tell us about the relationship between different species, as well as how much time has elapsed since they diverged from each other.
Let's view an interactive phylogenetic tree of Archaea, Bacteria, and Eukaryotes, called Interactive Tree of Life
Interactive Tree of Life
Create your own tree!
Copy the rubisco sequence and paste it in the text box on this page
Now, let's visit Deep Tree and take a trip through evolutionary time!
Once you arrive at the Deep Tree page, click on the Deep Tree logo that is shaped like a hexagon
Type and select a species of your choice in the search bar
Click the magnifying glass icon to launch the tree!
Back to Main Activity Page Next Activity